General Information

  • ID:  hor007184
  • Uniprot ID:  Q63434
  • Protein name:  Placenta growth factor
  • Gene name:  CCK
  • Organism:  Rattus norvegicus
  • Family:  PDGF/VEGF growth factor family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0005615 extracellular space; GO:0016020 membrane
  • GO BP:  GO:0042802 identical protein binding; GO:0008083 growth factor activity; GO:0042056 chemoattractant activity; GO:0005172 vascular endothelial growth factor receptor binding; GO:0044877 protein-containing complex binding
  • GO CC:  GO:0048010 vascular endothelial growth factor receptor signaling pathway; GO:0038084 vascular endothelial growth factor signaling pathway; GO:0030154 cell differentiation; GO:0007565 female pregnancy; GO:0032870 cellular response to hormone stimulus; GO:0001658 branching involved in ureteric bud morphogenesis; GO:0031100 animal organ regeneration; GO:0010467 gene expression; GO:0005977 glycogen metabolic process; GO:0008284 positive regulation of cell population proliferation; GO:0001938 positive regulation of endothelial cell proliferation; GO:0008217 regulation of blood pressure; GO:0045766 positive regulation of angiogenesis; GO:0051781 positive regulation of cell division; GO:0002040 sprouting angiogenesis; GO:0009410 response to xenobiotic stimulus; GO:0001666 response to hypoxia; GO:0001934 positive regulation of protein phosphorylation; GO:0060688 regulation of morphogenesis of a branching structure; GO:0050930 induction of positive chemotaxis; GO:0060754 positive regulation of

Sequence Information

  • Sequence:  LSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTPQTEEPHL
  • Length:  134
  • Propeptide:  MLAMKLFTCFLQVLAGLAVHSQGALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTPQTEEPHL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA